Mouse Anti-srp19 Antibody (CBMOAB-07331FYB)


Cat: CBMOAB-07331FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07331FYB Monoclonal Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Malaria parasite, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rice (Oryza) WB, ELISA MO07331FYB 100 µg
CBMOAB-31977FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO31977FYA 100 µg
CBMOAB-41780FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO41780FC 100 µg
CBMOAB-89529FYB Monoclonal Rice (Oryza) WB, ELISA MO89529FYB 100 µg
MO-AB-08010H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08010C 100 µg
MO-AB-11275W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11275W 100 µg
MO-AB-13318Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13318Y 100 µg
MO-AB-17104H Monoclonal Malaria parasite WB, ELISA MO17104C 100 µg
MO-AB-20893R Monoclonal Cattle (Bos taurus) WB, ELISA MO20893R 100 µg
MO-AB-29198H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29198C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Malaria parasite, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rice (Oryza)
CloneMO07331FYB
SpecificityThis antibody binds to Zebrafish srp19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSRP19 (Signal Recognition Particle 19) is a Protein Coding gene. Among its related pathways are Gene Expression and Viral mRNA Translation. Gene Ontology (GO) annotations related to this gene include 7S RNA binding. An important paralog of this gene is ENSG00000272869.
Product OverviewMouse Anti-Zebrafish srp19 Antibody is a mouse antibody against srp19. It can be used for srp19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSignal recognition particle 19; srp1
UniProt IDQ7T3C9
Protein RefseqThe length of the protein is 141 amino acids long.
The sequence is show below: MAYLTTNPADKERFLCIYPAYINSKKTLAEGRRIPTDKAVENPTCAEIQGVLSAAGLNVHVENSMYPREWNRDVQFRGRVRVQLKMEDGSFCQDKFTSRKDVMFYVAEMIPKLKSRTQKSGGAEAGAQQGEGGKKGKKKKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry