Mouse Anti-srsf9 Antibody (CBMOAB-07429FYB)
Cat: CBMOAB-07429FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-07429FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO07429FYB | 100 µg | ||
| CBMOAB-59113FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59113FYA | 100 µg | ||
| MO-AB-08030H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08030C | 100 µg | ||
| MO-AB-20920R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20920R | 100 µg | ||
| MO-AB-23902W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23902W | 100 µg | ||
| MO-AB-29209H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29209C | 100 µg | ||
| MO-AB-33529W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33529W | 100 µg | ||
| MO-AB-65378W | Monoclonal | Marmoset | WB, ELISA | MO65378W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO07429FYB |
| Specificity | This antibody binds to Zebrafish srsf9. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene. |
| Product Overview | Mouse Anti-Zebrafish srsf9 Antibody is a mouse antibody against srsf9. It can be used for srsf9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Zgc:77449 protein; srsf |
| UniProt ID | A8WG53 |
| Protein Refseq | The length of the protein is 246 amino acids long. The sequence is show below: MSDGRIYVGNLPMDVQERDIEDLFFKYGKIRDIELKNNRSTIPFAFVRFEDPRDAEDAVFGRNGYGFGDCKLRVEYPRSSGSKFSGPAGGGGGGGGPRGRFGPPTRRSEFRVIVTGLPPTGSWQDLKDHMREAGDVCFADVQRDGEGVVEFLRREDMEYALRRLDSTEFRSHQGETAYIRVMEERGTSWGRSRSRSRSRGRYTPPYQSRGSPPPRYRSPPRHMTRHSPPSRRPPLQHHSPPPRHYR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry