Mouse Anti-srsf9 Antibody (CBMOAB-07429FYB)


Cat: CBMOAB-07429FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07429FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO07429FYB 100 µg
CBMOAB-59113FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59113FYA 100 µg
MO-AB-08030H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08030C 100 µg
MO-AB-20920R Monoclonal Cattle (Bos taurus) WB, ELISA MO20920R 100 µg
MO-AB-23902W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23902W 100 µg
MO-AB-29209H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29209C 100 µg
MO-AB-33529W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33529W 100 µg
MO-AB-65378W Monoclonal Marmoset WB, ELISA MO65378W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO07429FYB
SpecificityThis antibody binds to Zebrafish srsf9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish srsf9 Antibody is a mouse antibody against srsf9. It can be used for srsf9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:77449 protein; srsf
UniProt IDA8WG53
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: MSDGRIYVGNLPMDVQERDIEDLFFKYGKIRDIELKNNRSTIPFAFVRFEDPRDAEDAVFGRNGYGFGDCKLRVEYPRSSGSKFSGPAGGGGGGGGPRGRFGPPTRRSEFRVIVTGLPPTGSWQDLKDHMREAGDVCFADVQRDGEGVVEFLRREDMEYALRRLDSTEFRSHQGETAYIRVMEERGTSWGRSRSRSRSRGRYTPPYQSRGSPPPRYRSPPRHMTRHSPPSRRPPLQHHSPPPRHYR.
For Research Use Only | Not For Clinical Use.
Online Inquiry