Mouse Anti-sssca1 Antibody (CBMOAB-07489FYB)


Cat: CBMOAB-07489FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07489FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset WB, ELISA MO07489FYB 100 µg
MO-AB-08050H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08050C 100 µg
MO-AB-20952R Monoclonal Cattle (Bos taurus) WB, ELISA MO20952R 100 µg
MO-AB-65415W Monoclonal Marmoset WB, ELISA MO65415W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset
CloneMO07489FYB
SpecificityThis antibody binds to Zebrafish sssca1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis antigen is recognized by a subset of anti-centromere antibodies from patients with scleroderma and/or Sjogren's syndrome. Subcellular localization has not yet been established. (From NCBI)
Product OverviewMouse Anti-Zebrafish sssca1 Antibody is a mouse antibody against sssca1. It can be used for sssca1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:103754; sssca1; zgc:10375
UniProt IDQ5XJ32
Protein RefseqThe length of the protein is 234 amino acids long.
The sequence is show below: MALNADDEDFEWEPPSEAEMKVIQARRERQDKISKLMGDYLLKGYKMLGECCELCGTILLQDKQKKNYCVACQELDSDVDKDNPALNAQAALSQVRERQLATQPVPESNGASSSEPPLSITGQPRPEHCEGAASGLRGPPPTVQPTPLSIPTPASNFLPPSNPPVQTTPPVGSSGSSLHHHPALSSAEEAVLHKLRWATQELQHAASVEASIQLCNLIRGCAESLRSLKELQLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry