Mouse Anti-st3gal5 Antibody (CBMOAB-07577FYB)


Cat: CBMOAB-07577FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07577FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries), Marmoset WB, ELISA MO07577FYB 100 µg
CBMOAB-59174FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59174FYA 100 µg
MO-AB-04164Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04164Y 100 µg
MO-AB-20968R Monoclonal Cattle (Bos taurus) WB, ELISA MO20968R 100 µg
MO-AB-23002W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23002W 100 µg
MO-AB-65434W Monoclonal Marmoset WB, ELISA MO65434W 100 µg
MO-DKB-00740W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries), Marmoset
CloneMO07577FYB
SpecificityThis antibody binds to Zebrafish st3gal5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionST3GAL5 (ST3 Beta-Galactoside Alpha-2,3-Sialyltransferase 5) is a Protein Coding gene. Diseases associated with ST3GAL5 include Salt And Pepper Developmental Regression Syndrome and Salt And Pepper Syndrome.
Product OverviewMouse Anti-Zebrafish st3gal5 Antibody is a mouse antibody against st3gal5. It can be used for st3gal5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-2,3-sialyltransferase; Ganglioside GM3 synthase; EC 2.4.99.9; st3gal5; st3Gal V st3Gal-
UniProt IDQ705K5
Protein RefseqThe length of the protein is 364 amino acids long.
The sequence is show below: MRRVMKQSSCYFSKRTMILLLSLALMSLAFLKLPSFHTELKPVEVPVDNKFRKRVHSHVREILDKECRPSFARQRMVTEHHGSTPTIDPFLNKNMKLDEQIFQYPPPFGFLDMKKKLEEILNLLPVSSEQRLGERDCRRCVVVGNGGILKGLGLGHLLNRFDIIIRLNSGPLQDFSADVGNRTTIRMSYPESCPKVWEDTDPDLKYVAVIFKSVDFHWLRAMISRTPVSLWDRLFFWQNVPMSVPVKTSQFHLLNPQIIREMALDLLNYPEPKKRLWSWDQNIPTLGLTALNLATYICDEVSLAGFGYNLSQKEAPLHYYDSVPMTTILKEAMHNVQKETVFLKRLVASGSITDLTGGIHCSFC.
For Research Use Only | Not For Clinical Use.
Online Inquiry