Mouse Anti-stam2 Antibody (CBMOAB-07672FYB)


Cat: CBMOAB-07672FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07672FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO07672FYB 100 µg
CBMOAB-59230FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59230FYA 100 µg
MO-AB-04173Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04173Y 100 µg
MO-AB-08072H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08072C 100 µg
MO-AB-20991R Monoclonal Cattle (Bos taurus) WB, ELISA MO20991R 100 µg
MO-AB-21618W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21618W 100 µg
MO-AB-65459W Monoclonal Marmoset WB, ELISA MO65459W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO07672FYB
SpecificityThis antibody binds to Zebrafish stam2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish stam2 Antibody is a mouse antibody against stam2. It can be used for stam2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesstam2
UniProt IDF1QHB2
Protein RefseqThe length of the protein is 517 amino acids long.
The sequence is show below: MPLFGQNPFDQDVEKATSETNTVEDWGLIMDICDRVGTAPNGAKDCLRSIMKRVNHKVPHVAMQALTLLGACVANSGKIFHLEICSREFASEVRGVLNRAHPKVNEKLKALMAEWAEDFQKDPQLSLIGATIKSLKEEGVTFPTANPQSSSTKPSSTPATSRASADDDLAKAIELSLQEQKQQTETRPLTVIADPPYNTNGGKESRKVRALYDFEAAEDNELTFKAGELVIILDDSDPNWWKGENHRGVGLFPSNFVTTNLNAEPDPVMYVEKTVVPEEPIVEVKAEPEPVYIDEEKMDKTLYLLQNTDPADATPDGPELLTLEDACEKMNPLIDEKLQEIDRKHSELSELNVKVLEALELYNQLMNEAPLYNAYSKMQSLQGTYPAAPPHLSMQVGHLKEELGYQPSGAYMSAGVPQGYSLTDQAGPLCSMPPSINSVAPSQPAQPSYISGPMNAPYVNQAPGGPTPYPPQMGVAMDMSAYQNANPGLPPTSYPMSAPAQPAPQQQQAAFYQQPLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry