Mouse Anti-stoml1 Antibody (CBMOAB-07852FYB)


Cat: CBMOAB-07852FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07852FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO07852FYB 100 µg
CBMOAB-59319FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59319FYA 100 µg
MO-AB-08126H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08126C 100 µg
MO-AB-19830W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19830W 100 µg
MO-AB-65552W Monoclonal Marmoset WB, ELISA MO65552W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO07852FYB
SpecificityThis antibody binds to Zebrafish stoml1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish stoml1 Antibody is a mouse antibody against stoml1. It can be used for stoml1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesstoml1
UniProt IDF1Q9K0
Protein RefseqThe length of the protein is 410 amino acids long.
The sequence is show below: MSLFGKSSGYEYQCLSQGESGYGETPGLFSSHSPFNNSHHDHRGHSFDYVPKVHQNDYTDKSQGLLSWLCNLIVTFLVFLFTFVTFPISGWFVLKVVPNYERVVVFRLGRIRPPKGPGVVLILPFIDQWQRVDLRTRAFNIPPCKVCTKDGGLVSVGADIQFRIWSPVMSVVAVQDLNSSTRLTAQNAMMTSLSKKSLREIQTDRLKLGEHLGMDMNEMTKPWGLEVDRVELILEGVVREPDGGHSGPLIMPPSVPGLEGLTGPIQQLAMHFLSQTTASQCTQDTVSFSDELHAVSSVSSVNELIETVRSVLSEELVHQVGACFHFHITTNSGQTSSYYVDLTQGRGACGAGVLQREPDVSLCMSEQDLLAMFQGSLQPFAAYSSGRLRVQGDLNTAMKLNTLIKLLKAR.
For Research Use Only | Not For Clinical Use.
Online Inquiry