Mouse Anti-suclg1 Antibody (CBMOAB-07992FYB)


Cat: CBMOAB-07992FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07992FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO07992FYB 100 µg
CBMOAB-59386FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59386FYA 100 µg
MO-AB-08158H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08158C 100 µg
MO-AB-13355Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13355Y 100 µg
MO-AB-21107R Monoclonal Cattle (Bos taurus) WB, ELISA MO21107R 100 µg
MO-AB-25188W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25188W 100 µg
MO-AB-30527R Monoclonal Pig (Sus scrofa) WB, ELISA MO30527R 100 µg
MO-AB-43462W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43462W 100 µg
MO-AB-65615W Monoclonal Marmoset WB, ELISA MO65615W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO07992FYB
SpecificityThis antibody binds to Zebrafish suclg1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSuccinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.
Product OverviewMouse Anti-Zebrafish suclg1 Antibody is a mouse antibody against suclg1. It can be used for suclg1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuccinate-CoA ligase, GDP-forming, alpha subunit; suclg
UniProt IDQ6DGX1
Protein RefseqThe length of the protein is 324 amino acids long.
The sequence is show below: MSHSRLFARLLLQQAGVRHCYSGSRNNLYINKNTKVICQGFTGKQGTFHSQQSLDYGSQLVGGVSPGKGGKTHLGLPVFNSVKEAKDGTGAEATVIYVPPPFAAAAIIEAIDAEMPLAVCITEGIPQQDMVRVKHRLLRQNKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLPYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLEVFLQDPKTEGIILIGEIGGDAEENAAEYLKQHNSGANAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAGVVVSMSPAQLGSTIFKEFEKRKML.
For Research Use Only | Not For Clinical Use.
Online Inquiry