Mouse Anti-suclg2 Antibody (CBMOAB-07994FYB)
Cat: CBMOAB-07994FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-07994FYB | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07994FYB | 100 µg | ||
CBMOAB-59387FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59387FYA | 100 µg | ||
MO-AB-06328W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06328W | 100 µg | ||
MO-AB-07358W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07358W | 100 µg | ||
MO-AB-08159H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08159C | 100 µg | ||
MO-AB-10127Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10127Y | 100 µg | ||
MO-AB-13755W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13755W | 100 µg | ||
MO-AB-21108R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21108R | 100 µg | ||
MO-AB-30529R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30529R | 100 µg | ||
MO-AB-33578W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33578W | 100 µg | ||
MO-AB-42652W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42652W | 100 µg | ||
MO-AB-43463W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43463W | 100 µg | ||
MO-AB-46727W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46727W | 100 µg | ||
MO-AB-65617W | Monoclonal | Marmoset | WB, ELISA | MO65617W | 100 µg | ||
MO-DKB-00676W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) |
Clone | MO07994FYB |
Specificity | This antibody binds to Zebrafish suclg2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | GTP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit. |
Product Overview | Mouse Anti-Zebrafish suclg2 Antibody is a mouse antibody against suclg2. It can be used for suclg2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Succinyl-CoA ligase subunit beta; EC 6.2.1.-; suclg |
UniProt ID | F1R7X5 |
Protein Refseq | The length of the protein is 432 amino acids long. The sequence is show below: MAASVACQAAARGLRSASTKQLLVCRNQLTRVSPRRWLNLQEYQSKKLMQDSGVAVQRFFVADTASEALEAAKRLKAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPAVVGELASKMLGYNLTTKQTPKEGVEVKTVMVAEALDISRETYFAILMDRSCNGPVMVGSPQGGMDIEEVAAATPELIFKEVIDIFEGVRDDQALRMAANLGFKGPLERQAADQIKRLYDLFLKVDATQVEVNPLGETPEGQVVCFDAKINFDDNAEFRQKAVFSMDDTAESDPIETEAAKYDLKYIGMDGNIACFVNGAGLAMATCDIIDLHGGKPANFLDLGGGVKENQVYAAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAKRILSESGLPITSATDLDDAARKAVAAIAKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry