Mouse Anti-suclg2 Antibody (CBMOAB-07994FYB)


Cat: CBMOAB-07994FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07994FYB Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) WB, ELISA MO07994FYB 100 µg
CBMOAB-59387FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59387FYA 100 µg
MO-AB-06328W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06328W 100 µg
MO-AB-07358W Monoclonal Cat (Felis catus) WB, ELISA MO07358W 100 µg
MO-AB-08159H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08159C 100 µg
MO-AB-10127Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10127Y 100 µg
MO-AB-13755W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13755W 100 µg
MO-AB-21108R Monoclonal Cattle (Bos taurus) WB, ELISA MO21108R 100 µg
MO-AB-30529R Monoclonal Pig (Sus scrofa) WB, ELISA MO30529R 100 µg
MO-AB-33578W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33578W 100 µg
MO-AB-42652W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42652W 100 µg
MO-AB-43463W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43463W 100 µg
MO-AB-46727W Monoclonal Horse (Equus caballus) WB, ELISA MO46727W 100 µg
MO-AB-65617W Monoclonal Marmoset WB, ELISA MO65617W 100 µg
MO-DKB-00676W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus)
CloneMO07994FYB
SpecificityThis antibody binds to Zebrafish suclg2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGTP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit.
Product OverviewMouse Anti-Zebrafish suclg2 Antibody is a mouse antibody against suclg2. It can be used for suclg2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuccinyl-CoA ligase subunit beta; EC 6.2.1.-; suclg
UniProt IDF1R7X5
Protein RefseqThe length of the protein is 432 amino acids long.
The sequence is show below: MAASVACQAAARGLRSASTKQLLVCRNQLTRVSPRRWLNLQEYQSKKLMQDSGVAVQRFFVADTASEALEAAKRLKAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPAVVGELASKMLGYNLTTKQTPKEGVEVKTVMVAEALDISRETYFAILMDRSCNGPVMVGSPQGGMDIEEVAAATPELIFKEVIDIFEGVRDDQALRMAANLGFKGPLERQAADQIKRLYDLFLKVDATQVEVNPLGETPEGQVVCFDAKINFDDNAEFRQKAVFSMDDTAESDPIETEAAKYDLKYIGMDGNIACFVNGAGLAMATCDIIDLHGGKPANFLDLGGGVKENQVYAAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAKRILSESGLPITSATDLDDAARKAVAAIAKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry