Mouse Anti-SUMO1 Antibody (CBMOAB-41932FYC)
Cat: CBMOAB-41932FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-41932FYC | Monoclonal | WB, ELISA | MO41932FC | 100 µg | |||
CBMOAB-59447FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59447FYA | 100 µg | ||
CBMOAB-89596FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89596FYB | 100 µg | ||
MO-AB-01480L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01480L | 100 µg | ||
MO-AB-01698R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01698R | 100 µg | ||
MO-AB-07688W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07688W | 100 µg | ||
MO-AB-13357Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13357Y | 100 µg | ||
MO-AB-21136R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21136R | 100 µg | ||
MO-AB-23421W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23421W | 100 µg | ||
MO-AB-29284H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29284C | 100 µg | ||
MO-AB-33594W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33594W | 100 µg | ||
MO-AB-33865H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33865C | 100 µg | ||
MO-AB-38245W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38245W | 100 µg | ||
MO-AB-42659W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42659W | 100 µg | ||
MO-AB-46741W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46741W | 100 µg | ||
MO-AB-65657W | Monoclonal | Marmoset | WB, ELISA | MO65657W | 100 µg | ||
MO-DKB-01099W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Dog (Canis lupus familiaris), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | 100 µg | |||
MO-DKB-01729W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
MO-DKB-0520RA | Polyclonal | WB | 1.5 mg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); Rice (Oryza); S. tuberosum (Solanum tuberosum), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Goat (Capra hircus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rice (Oryza) |
Clone | MO41932FC |
Specificity | This antibody binds to Arabidopsis SUMO1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Required for the massive protein sumoylation in the nucleus induced by heat shock and controlled by SIZ1. Involved in the regulation of the heat stress transcription factor HSFA2 in acquired thermotolerance. |
Product Overview | Mouse Anti-Arabidopsis SUMO1 Antibody is a mouse antibody against SUMO1. It can be used for SUMO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Small ubiquitin-related modifier 1; AtSUMO1; Ubiquitin-like protein SMT3; SUMO1; SMT3 SUM1; At4g26840 |
UniProt ID | P55852 |
Protein Refseq | The length of the protein is 100 amino acids long. The sequence is show below: MSANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGGSGGGATA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry