Mouse Anti-SUMO3 Antibody (CBMOAB-41935FYC)
Cat: CBMOAB-41935FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-41935FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO41935FC | 100 µg | ||
| CBMOAB-59449FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59449FYA | 100 µg | ||
| MO-AB-01702R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01702R | 100 µg | ||
| MO-AB-13361Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13361Y | 100 µg | ||
| MO-AB-21138R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21138R | 100 µg | ||
| MO-AB-23501W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23501W | 100 µg | ||
| MO-AB-29287H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29287C | 100 µg | ||
| MO-AB-42661W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42661W | 100 µg | ||
| MO-AB-46742W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46742W | 100 µg | ||
| MO-AB-65660W | Monoclonal | Marmoset | WB, ELISA | MO65660W | 100 µg | ||
| MO-DKB-02510W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
| MO-DKB-0521RA | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 50 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO41935FC |
| Specificity | This antibody binds to Arabidopsis SUMO3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process (By similarity). |
| Product Overview | Mouse Anti-Arabidopsis SUMO3 Antibody is a mouse antibody against SUMO3. It can be used for SUMO3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Small ubiquitin-related modifier 3; AtSUMO3; SUMO3; SUM3; At5g55170 |
| UniProt ID | Q9FLP5 |
| Protein Refseq | The length of the protein is 111 amino acids long. The sequence is show below: MSNPQDDKPIDQEQEAHVILKVKSQDGDEVLFKNKKSAPLKKLMYVYCDRRGLKLDAFAFIFNGARIGGLETPDELDMEDGDVIDACRAMSGGLRANQRQWSYMLFDHNGL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry