Mouse Anti-TAC1 Antibody (CBMOAB-44768FYC)


Cat: CBMOAB-44768FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44768FYC Monoclonal A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chicken (Gallus gallus), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO44768FC 100 µg
CBMOAB-59644FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59644FYA 100 µg
CBMOAB-08491FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO08491FYB 100 µg
CBMOAB-11865HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO11865HB 100 µg
MO-AB-42668W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42668W 100 µg
MO-AB-46747W Monoclonal Horse (Equus caballus) WB, ELISA MO46747W 100 µg
MO-AB-01712R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01712R 100 µg
MO-AB-30561R Monoclonal Pig (Sus scrofa) WB, ELISA MO30561R 100 µg
MO-AB-08236H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08236C 100 µg
MO-AB-29327H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29327C 100 µg
MO-AB-04206Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04206Y 100 µg
MO-AB-10155Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10155Y 100 µg
MO-AB-13370Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13370Y 100 µg
MO-AB-17845Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17845Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chicken (Gallus gallus), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO44768FC
SpecificityThis antibody binds to Arabidopsis TAC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Substance P is an antimicrobial peptide with antibacterial and antifungal properties. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Arabidopsis TAC1 Antibody is a mouse antibody against TAC1. It can be used for TAC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTachykinin Precursor 1; Tachykinin, Precursor 1 (Substance K, Substance P, Neurokinin 1, Neurokinin 2, Neuromedin L, Neurokinin Alpha, Neuropeptide K, Neuropeptide Gamma); Neuropeptide Gamma; Neurokinin Alpha; Preprotachykinin; Neuropeptide K; Protachykinin; Neurokinin 1; Neurokinin 2; Neuromedin L; Substance K; Substance P
UniProt IDQ9SR34
Protein RefseqThe length of the protein is 172 amino acids long. The sequence is show below: MENIKNPKNADDCSDSISKNSHQGVDDSLNQSRSYVCSFCIRGFSNAQALGGHMNIHRRDRAKLRQKLMEDNKDDVVAESDASEVVSLDLNEQQQQQGEALTCDDHDQYVDNDISPKQKLEFWVQESKLDTNDHGKVTEASIDGSSSSHHRDIEVLDLELRLGQSVVKKKTT.
See other products for " TAC1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry