Mouse Anti-TAC1 Antibody (CBMOAB-44768FYC)
Cat: CBMOAB-44768FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-44768FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chicken (Gallus gallus), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO44768FC | 100 µg | ||
CBMOAB-59644FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59644FYA | 100 µg | ||
CBMOAB-08491FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO08491FYB | 100 µg | ||
CBMOAB-11865HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO11865HB | 100 µg | ||
MO-AB-42668W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42668W | 100 µg | ||
MO-AB-46747W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46747W | 100 µg | ||
MO-AB-01712R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01712R | 100 µg | ||
MO-AB-30561R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30561R | 100 µg | ||
MO-AB-08236H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08236C | 100 µg | ||
MO-AB-29327H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29327C | 100 µg | ||
MO-AB-04206Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04206Y | 100 µg | ||
MO-AB-10155Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10155Y | 100 µg | ||
MO-AB-13370Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13370Y | 100 µg | ||
MO-AB-17845Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17845Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Chicken (Gallus gallus), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO44768FC |
Specificity | This antibody binds to Arabidopsis TAC1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Substance P is an antimicrobial peptide with antibacterial and antifungal properties. Multiple transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Arabidopsis TAC1 Antibody is a mouse antibody against TAC1. It can be used for TAC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tachykinin Precursor 1; Tachykinin, Precursor 1 (Substance K, Substance P, Neurokinin 1, Neurokinin 2, Neuromedin L, Neurokinin Alpha, Neuropeptide K, Neuropeptide Gamma); Neuropeptide Gamma; Neurokinin Alpha; Preprotachykinin; Neuropeptide K; Protachykinin; Neurokinin 1; Neurokinin 2; Neuromedin L; Substance K; Substance P |
UniProt ID | Q9SR34 |
Protein Refseq | The length of the protein is 172 amino acids long. The sequence is show below: MENIKNPKNADDCSDSISKNSHQGVDDSLNQSRSYVCSFCIRGFSNAQALGGHMNIHRRDRAKLRQKLMEDNKDDVVAESDASEVVSLDLNEQQQQQGEALTCDDHDQYVDNDISPKQKLEFWVQESKLDTNDHGKVTEASIDGSSSSHHRDIEVLDLELRLGQSVVKKKTT. |
See other products for " TAC1 "
MO-AB-21217R | Mouse Anti-TAC1 Antibody (MO-AB-21217R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry