Mouse Anti-tada2b Antibody (CBMOAB-08520FYB)


Cat: CBMOAB-08520FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08520FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO08520FYB 100 µg
CBMOAB-59669FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59669FYA 100 µg
MO-AB-11710W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11710W 100 µg
MO-AB-65790W Monoclonal Marmoset WB, ELISA MO65790W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO08520FYB
SpecificityThis antibody binds to Zebrafish tada2b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTADA2B functions as a transcriptional adaptor protein that potentiates transcription through coordination of histone acetyltransferase (HAT) activity and by linking activation factors to basal transcriptional machinery (Barlev et al., 2003 [PubMed 12972612]).
Product OverviewMouse Anti-Zebrafish tada2b Antibody is a mouse antibody against tada2b. It can be used for tada2b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscriptional adapter 2-beta; tada2
UniProt IDQ503N9
Protein RefseqThe length of the protein is 486 amino acids long.
The sequence is show below: MADLGKKYCVNCLADVTNLRIRCAECQDIELCPECFSAGAEIGNHRRWHGYQQVDGGRFSLWGPEAEGGWTSREEQSLLDAIEQYGFGNWEDMAAHVGASRTPQEVMDHYVSMYIHGNLGKACIPDSIPNRVTDHTCPSGGPLSPSLTTPLPPLDITVVEQQQLGYMPLRDDYEIEYDQEAEKLISGLSVNYDDEDIEIEMKRAHVDMYVRKLRERQRRKNIARDYNLVPAFLGRDKKDKERERAGGTVGVGGPGGAVGSGSGATVVPAGPLGSSTAATPKRKITKEEKGQRTKLRALCQFMPQREFEEFFDNMHKERMLRAKVRELQRYRRNGITRLDESAEYEAARHKREKRKENKSIAGSKRGSSGGGGGTAGLGGGVGAGGGLGGGGGVSTIKEEGKDSEFSAIENLSGFELLSDREKVLCNSMNLSPMRYLTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLSESGWISRDAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry