Mouse Anti-TAF13 Antibody (CBMOAB-44777FYC)
Cat: CBMOAB-44777FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44777FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) | WB, ELISA | MO44777FC | 100 µg | ||
| CBMOAB-32535FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO32535FYA | 100 µg | ||
| CBMOAB-08045FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO08045FYB | 100 µg | ||
| CBMOAB-04373CR | Monoclonal | Yeast | WB, ELISA | MO04373CR | 100 µg | ||
| CBMOAB-11876HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO11876HB | 100 µg | ||
| MO-AB-06404W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06404W | 100 µg | ||
| MO-AB-11358W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11358W | 100 µg | ||
| MO-AB-46751W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46751W | 100 µg | ||
| MO-AB-65799W | Monoclonal | Marmoset | WB, ELISA | MO65799W | 100 µg | ||
| MO-AB-21231R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21231R | 100 µg | ||
| MO-AB-08241H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08241C | 100 µg | ||
| MO-AB-29335H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29335C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) |
| Clone | MO44777FC |
| Specificity | This antibody binds to Arabidopsis TAF13. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. |
| Product Overview | Mouse Anti-Arabidopsis TAF13 Antibody is a mouse antibody against TAF13. It can be used for TAF13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | TATA-Box Binding Protein Associated Factor 13; TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa; TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase II, K, 18kD; Transcription Initiation Factor TFIID 18 KDa Subunit; TAF(II)18; TAFII-18 |
| UniProt ID | Q6NQH4 |
| Protein Refseq | The length of the protein is 126 amino acids long. The sequence is show below: MSNTPAAAASSSSKSKAAGTSQPQEKRKTLFQKELQHMMYGFGDEQNPLPESVALVEDIVVEYVTDLTHKAQEIGSKRGRLLVDDFLYLIRKDLPKLNRCRELLAMQEELKQARKAFDVDEKELVD. |
See other products for " TAF13 "
| MO-AB-13378Y | Mouse Anti-TAF13 Antibody (MO-AB-13378Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry