Mouse Anti-TEX14 Antibody (MO-AB-21442R)


Cat: MO-AB-21442R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-21442R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO21442R 100 µg
MO-AB-30622R Monoclonal Pig (Sus scrofa) WB, ELISA MO30622R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa)
CloneMO21442R
SpecificityThis antibody binds to Cattle TEX14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against TEX14. It can be used for TEX14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInactive serine/threonine-protein kinase TEX14; Testis-expressed sequence 14; Testis-expressed sequence 14 protein; TEX14
UniProt IDF1MJR8
Protein RefseqThe length of the protein is 1493 amino acids long.
The sequence is show below: MSRAVHLPVPCPVQLGSLRNDSLEAQLHEYVKQGNYVKVKRILKKGIYVDAVNSLGQTALFIAALLGLTKLVDVLVDYGADPNHRCFDGSTPVHAAAFSGNQWILSKLLDAGGDLRLHDEKGRNPQTWALAAGKERSTVMVEFMQRCAAHMQAIIQGFSDLLKKIDSPQRLISGVPRFGGLMQGNPNGSPNRPPKAGVISAQNIYSFGFGKFYLTGGTQLAYLGSLPVIGEKEVIQADDEPTFSFFSGPYMVMTN.
For Research Use Only | Not For Clinical Use.
Online Inquiry