AibGenesis™ Mouse Anti-THEM4 Antibody (CBMOAB-60166FYA)


Cat: CBMOAB-60166FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60166FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO60166FYA 100 µg
MO-AB-20216W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20216W 100 µg
MO-AB-21539R Monoclonal Cattle (Bos taurus) WB, ELISA MO21539R 100 µg
MO-AB-29443H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29443C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO60166FYA
SpecificityThis antibody binds to Rhesus THEM4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus THEM4 Antibody is a mouse antibody against THEM4. It can be used for THEM4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThioesterase superfamily member 4; THEM4
UniProt IDH9F2N5
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: RSCAARLRTLGALRGPPGGRRLPGREPRPALRSFSSEEVILKDYSVPNPSWNKDLRLLFDQFMEKCEDGSWKRLPSYKRIPAEKIQDFKTHLLDPKLVKEEQLSQTQLFTRSFDDGLGFEYVMFYSDVEKRMVCLFQGGPYLEGPPGFVHGGAIATMIDSTVGMCALMAGGVVVTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSIFIKLNPAKSLT.
For Research Use Only | Not For Clinical Use.
Online Inquiry