AibGenesis™ Mouse Anti-TLL2 Antibody (CBMOAB-60312FYA)


Cat: CBMOAB-60312FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60312FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO60312FYA 100 µg
MO-AB-01514L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01514L 100 µg
MO-AB-07355W Monoclonal Cat (Felis catus) WB, ELISA MO07355W 100 µg
MO-AB-08455H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08455C 100 µg
MO-AB-17923Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17923Y 100 µg
MO-AB-21640R Monoclonal Cattle (Bos taurus) WB, ELISA MO21640R 100 µg
MO-AB-21774W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21774W 100 µg
MO-AB-23799H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23799C 100 µg
MO-AB-30686R Monoclonal Pig (Sus scrofa) WB, ELISA MO30686R 100 µg
MO-AB-33744W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33744W 100 µg
MO-AB-35831W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35831W 100 µg
MO-AB-42700W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42700W 100 µg
MO-AB-46813W Monoclonal Horse (Equus caballus) WB, ELISA MO46813W 100 µg
MO-AB-66267W Monoclonal Marmoset WB, ELISA MO66267W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO60312FYA
SpecificityThis antibody binds to Rhesus TLL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an astacin-like zinc-dependent metalloprotease and is a subfamily member of the metzincin family. Unlike other family members, a similar protein in mice does not cleave procollagen C-propeptides or chordin. (From NCBI)
Product OverviewMouse Anti-Rhesus TLL2 Antibody is a mouse antibody against TLL2. It can be used for TLL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTolloid-like protein 2; TLL2
UniProt IDH9FJ15
Protein RefseqThe length of the protein is 190 amino acids long.
The sequence is show below: LDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDKVPEPLVSTDSRLWVEFRSSSNILGKGFFAVYEATCGGDINKDAGQIQSPNYPDDYRPSKECVWRITVSEGFH.
For Research Use Only | Not For Clinical Use.
Online Inquiry