Mouse Anti-TOE1 Antibody (CBMOAB-45160FYC)
Cat: CBMOAB-45160FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
- Relate Reference Data
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-45160FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO45160FC | 100 µg | ||
CBMOAB-10328FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO10328FYB | 100 µg | ||
CBMOAB-12243HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO12243HB | 100 µg | ||
MO-AB-20454W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20454W | 100 µg | ||
MO-AB-66673W | Monoclonal | Marmoset | WB, ELISA | MO66673W | 100 µg | ||
MO-AB-22021R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22021R | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) |
Clone | MO45160FC |
Specificity | This antibody binds to Arabidopsis TOE1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | TOE1 (Target Of EGR1, Exonuclease) is a Protein Coding gene. Diseases associated with TOE1 include Pontocerebellar Hypoplasia, Type 7 and Pontocerebellar Hypoplasia. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. |
Product Overview | Mouse Anti-Arabidopsis TOE1 Antibody is a mouse antibody against TOE1. It can be used for TOE1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Target Of EGR1, Exonuclease; Target Of EGR1, Member 1 (Nuclear); Target Of EGR1 Protein 1; HCaf1z; PCH7 |
UniProt ID | B2CVW9 |
Protein Refseq | The length of the protein is 94 amino acids long. The sequence is show below: PYGSSDHRLYWNGACPSYNNPAEGRATEKRSEAEGMMSNWGWQRPGQTSTVRPQPPGPQPPPLFSVAAASSGFSHFRPQPPNDNATRGYFYPQP. |
Reference
Reference | 1. Werner, S., Bartrina, I., & Schmülling, T. (2021). Cytokinin regulates vegetative phase change in Arabidopsis thaliana through the miR172/TOE1-TOE2 module. Nature communications, 12(1), 5816. 2. Liu, Y., Yang, S., Khan, A. R., & Gan, Y. (2023). TOE1/TOE2 Interacting with GIS to Control Trichome Development in Arabidopsis. International Journal of Molecular Sciences, 24(7), 6698. |
Relate Reference Data
Figure 1 The expression on main stem of GL1, GL3 and TTG1 in the WT, 35S:TOE1, toe1, toe2 and 35S:miR172b. Error bars represent SE. Student's t-test was calculated at the probability of either 5%.
Reference: Liu, Y., Yang, S., Khan, A. R., & Gan, Y. (2023). TOE1/TOE2 Interacting with GIS to Control Trichome Development in Arabidopsis. International Journal of Molecular Sciences, 24(7), 6698.
For Research Use Only | Not For Clinical Use.
Online Inquiry