Mouse Anti-Tomato AIM1 Antibody (MO-AB-34131H)


Cat: MO-AB-34131H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityTomato (Lycopersicon esculentum)
CloneMO34131C
SpecificityThis antibody binds to Tomato AIM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in peroxisomal fatty acid beta-oxidation. Required for wound-induced jasmonate biosynthesis. Possesses enoyl-CoA hydratase activity against short chain substrates (C4-C6) and 3-hydroxyacyl-CoA dehydrogenase activity against chains of variable sizes (C6-C16) (PubMed:10521521, PubMed:17544464, PubMed:20463021). Possesses cinnamoyl-CoA hydratase activity and is involved in the peroxisomal beta-oxidation pathway for the biosynthesis of benzoic acid (BA). Required for the accumulation in seeds of benzoylated glucosinolates (BGs) and substituted hydroxybenzoylated choline esters, which are BA-containing secondary metabolites. Required for salicylic acid (SA) in seeds (PubMed:24254312).
Product OverviewThis product is a mouse antibody against AIM1. It can be used for AIM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABA-induced MYB transcription factor; AIM1
UniProt IDC0J8F7
Protein RefseqThe length of the protein is 243 amino acids long.
The sequence is show below: MDKLINQENNIDKEIMELRRGPWTVEEDLVLMNYISHHGEGRWNSLSRCAGLKRTGKSCRLRWLNYLRPNVRHGNITLEEQLLILQLHSRWGNRWSKITQHLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSRQFQDTLRYLWIPRLVERIEASKISNYNCINEAQQSIMRTHINNNFSTSVTLENSRVATSSKNSNQDYNQVNQSDQLWYEDYQAMDQQNNIELWMDNEDVFNNLCNIEDIWS.
For Research Use Only | Not For Clinical Use.
Online Inquiry