Mouse Anti-TREH Antibody (MO-AB-46904W)


Cat: MO-AB-46904W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-46904W Monoclonal Horse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO46904W 100 µg
CBMOAB-61074FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61074FYA 100 µg
CBMOAB-10646FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO10646FYB 100 µg
MO-AB-07723W Monoclonal Cat (Felis catus) WB, ELISA MO07723W 100 µg
MO-AB-21493W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21493W 100 µg
MO-AB-33832W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33832W 100 µg
MO-AB-35874W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35874W 100 µg
MO-AB-42733W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42733W 100 µg
MO-AB-66844W Monoclonal Marmoset WB, ELISA MO66844W 100 µg
MO-AB-22151R Monoclonal Cattle (Bos taurus) WB, ELISA MO22151R 100 µg
MO-AB-01803R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01803R 100 µg
MO-AB-30943R Monoclonal Pig (Sus scrofa) WB, ELISA MO30943R 100 µg
MO-AB-33928H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33928C 100 µg
MO-AB-01545L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01545L 100 µg
MO-AB-10312Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10312Y 100 µg
MO-AB-18049Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18049Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO46904W
SpecificityThis antibody binds to Horse TREH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that hydrolyses trehalose, a disaccharide formed from two glucose molecules found mainly in fungi, plants, and insects. A partial duplication of this gene is located adjacent to this locus on chromosome 11. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Horse TREH Antibody is a mouse antibody against TREH. It can be used for TREH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTrehalase; EC 3.2.1.28; Alpha-trehalose glucohydrolase; TREH
UniProt IDF7AG12
Protein RefseqThe length of the protein is583 amino acids long.
The sequence is show below: MPERTWELRLLLLLGLGLGSQEALPPPCESQIYCQGELLHQVQMAKLYQDDKQFVDMPLSSAPDQVLQRFNELAEAHNHSIPQQQLQLFVQEHFQPVGQELEPWTPEDWKESPQFLQTISDPNLRAWAGQLHQLWKKLGKKVKPEVLSHPEQFSLIYSEHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMPETVKGMLQNFLDLVQTYGHVPNGARVYYLQRSQPPLLTLMMDRYVTHTNDTAFLRDNIETLALEVDFWAENRSISVSSGGKSYVLNRYYVPYGGPRPESYSKDAELADTLPEGDREDLFAELKAGAESGWDFSSRWFIGGPNPDLLSSTRTSKFVPVDLNAFLCQAEELMSNFYARLGNDTQATKYRNLRAQRLAAMEAILWDEEKGAWFDYDLETGKKNAEFYPSNLAPLWAGCFSDLGDVDKALKYLEDSQILTYQYGIPTSLQKTGQQWDLPNAWAPLQDLVIRGLAKSPSPRAQEVAFQLAQNWIRTNFDVYSNTSAMYEKYDISNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLSSGTWTVFLEPHCLAASLLLSLLLSLLPQ.
See other products for " Treh "
For Research Use Only | Not For Clinical Use.
Online Inquiry