Mouse Anti-uchl5 Antibody (CBMOAB-08097FYB)


Cat: CBMOAB-08097FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08097FYB Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO08097FYB 100 µg
MO-AB-01588L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01588L 100 µg
MO-AB-01856R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01856R 100 µg
MO-AB-04681Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04681Y 100 µg
MO-AB-06972Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06972Y 100 µg
MO-AB-07330W Monoclonal Cat (Felis catus) WB, ELISA MO07330W 100 µg
MO-AB-08915H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08915C 100 µg
MO-AB-10384Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10384Y 100 µg
MO-AB-18127Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18127Y 100 µg
MO-AB-22553R Monoclonal Cattle (Bos taurus) WB, ELISA MO22553R 100 µg
MO-AB-23852H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23852C 100 µg
MO-AB-25362W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25362W 100 µg
MO-AB-31092R Monoclonal Pig (Sus scrofa) WB, ELISA MO31092R 100 µg
MO-AB-33918W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33918W 100 µg
MO-AB-35920W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35920W 100 µg
MO-AB-42789W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42789W 100 µg
MO-AB-46987W Monoclonal Horse (Equus caballus) WB, ELISA MO46987W 100 µg
MO-AB-67368W Monoclonal Marmoset WB, ELISA MO67368W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO08097FYB
SpecificityThis antibody binds to Zebrafish uchl5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProtease that specifically cleaves Lys-48-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.
Product OverviewMouse Anti-Zebrafish uchl5 Antibody is a mouse antibody against uchl5. It can be used for uchl5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesuchl5; Ubiquitin C-Terminal Hydrolase L5
UniProt IDE7F5E9
Protein RefseqThe length of the protein is 1077 amino acids long.
The sequence is show below: EFKEFSNSFDAAMKGLALSNSEVIRQVHNGFARQQMFEFDAKSTAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEKKIVELQAQLTEEEPMDTDQSGNHLSSIQSEIAKYQLLIEEENQKLKRYKVENIRRKHNYLPFIMELLKTLAEYQQLIPLVEKAKEKQSAKKIQEAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry