Mouse Anti-ugt8 Antibody (CBMOAB-11824FYB)


Cat: CBMOAB-11824FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11824FYB Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO11824FYB 100 µg
CBMOAB-12729HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO12729HB 100 µg
CBMOAB-61812FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61812FYA 100 µg
MO-AB-22580R Monoclonal Cattle (Bos taurus) WB, ELISA MO22580R 100 µg
MO-AB-31118R Monoclonal Pig (Sus scrofa) WB, ELISA MO31118R 100 µg
MO-AB-67393W Monoclonal Marmoset WB, ELISA MO67393W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO11824FYB
SpecificityThis antibody binds to Zebrafish ugt8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the UDP-glycosyltransferase family. It catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central and peripheral nervous systems. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Zebrafish ugt8 Antibody is a mouse antibody against ugt8. It can be used for ugt8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:136652 protein; ugt
UniProt IDQ566U9
Protein RefseqThe length of the protein is 542 amino acids long.
The sequence is show below: MKAFFVLATLLWCLATSLSWAAKIVVVPPIMFESHLYIFKTLASALHAEGHDTVFLVSEGREIPPSNHYRLQRYPGIFNSTSADDFLQSKVRNIFSGRLTALELFDILDHYSQNCDAVVGSTSVMEQLKREHFDLLLVDPNEMCGFVIAHILGVQYAVFSTGLWYPAEVGAPAPLSYVPEFNSLLTDHMSLFQRVANTAVYLVSRFGVQFLVLPKYDRIMRKYNIQPSVSMHDLVQNSRLWMLCTDMALEFPRPTLPHVVYVGGILTKPPSPLPQEFETWVKDTDEDGFVVVSFGAGVKYLSDDIAQKLAGALSRLPQRVIWRFSGVPPSNLGNNTKLVDWMPQNDLLGQTNTRAFLSHGGLNSIYEAMYHGVPVVGVPLFGDHYDTMTRVQAKGMGIMLEWKRMSEEDLYTAMVNVITDKRYRERAQLLSQIHKDQPGHPVSRAVYWISYILRHRGAEHLRSAVYEIPTYQYFLLDVAMVIGVCLLLTGYCLYRIVKCIQSRLGRGSSPGEKVNGHCHNGIPNGKHKRNGHVKSMEKKKKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry