Mouse Anti-VDAC3 Antibody (CBMOAB-45819FYC)


Cat: CBMOAB-45819FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
  • Relate Reference Data
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45819FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) WB, ELISA MO45819FC 100 µg
CBMOAB-62069FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62069FYA 100 µg
CBMOAB-15749FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO15749FYB 100 µg
CBMOAB-89807FYB Monoclonal Rice (Oryza) WB, ELISA MO89807FYB 100 µg
MO-AB-14523W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14523W 100 µg
MO-AB-47058W Monoclonal Horse (Equus caballus) WB, ELISA MO47058W 100 µg
MO-AB-67651W Monoclonal Marmoset WB, ELISA MO67651W 100 µg
MO-AB-22765R Monoclonal Cattle (Bos taurus) WB, ELISA MO22765R 100 µg
MO-AB-31187R Monoclonal Pig (Sus scrofa) WB, ELISA MO31187R 100 µg
MO-AB-09026H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09026C 100 µg
MO-AB-10460Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10460Y 100 µg
MO-DKB-02531W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio)
CloneMO45819FC
SpecificityThis antibody binds to Arabidopsis VDAC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Vacuole; Chloroplast; Plasma membrane; Cell Wall; Other locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene.
Product OverviewMouse Anti-Arabidopsis VDAC3 Antibody is a mouse antibody against VDAC3. It can be used for VDAC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVoltage Dependent Anion Channel 3; Outer Mitochondrial Membrane Protein Porin 3; VDAC-3; Voltage-Dependent Anion-Selective Channel Protein 3; HD-VDAC3; HVDAC3
UniProt IDQ9SMX3
Protein RefseqThe length of the protein is 274 amino acids long. The sequence is show below: MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQVKNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSPSTVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP.

Reference

Reference1. Hemono, M., Ubrig, É., Azeredo, K., Salinas-Giegé, T., Drouard, L., & Duchêne, A. M. (2020). Arabidopsis voltage-dependent anion channels (VDACs): overlapping and specific functions in mitochondria. Cells, 9(4), 1023.
2. Kwon, T. (2016). Mitochondrial porin isoform AtVDAC1 regulates the competence of Arabidopsis thaliana to Agrobacterium-mediated genetic transformation. Molecules and Cells, 39(9), 705.
3. Kanwar, P., Sanyal, S. K., Mahiwal, S., Ravi, B., Kaur, K., Fernandes, J. L., ... & Pandey, G. K. (2022). CIPK9 targets VDAC3 and modulates oxidative stress responses in Arabidopsis. The Plant Journal, 109(1), 241-260.
See other products for " VDAC3 "

Relate Reference Data

Figure 1 Effects of phytohormone pretreatment on transient T-DNA gene expression and expression profiles of AtVDAC gene family. Total RNAs were isolated from whole Arabidopsis WT plants cultivated in CIM for indicated periods. RNA blot analysis was conducted using each AtVDAC full length cDNA as a probe.
Reference: Kwon, T. (2016). Mitochondrial porin isoform AtVDAC1 regulates the competence of Arabidopsis thaliana to Agrobacterium-mediated genetic transformation. Molecules and Cells, 39(9), 705.

For Research Use Only | Not For Clinical Use.
Online Inquiry