AibGenesis™ Mouse Anti-Wnt2 Antibody (MO-AB-14041Y)
Cat: MO-AB-14041Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-14041Y | Monoclonal | Sea-anemone, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO14041Y | 100 µg | ||
| CBMOAB-34403FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO34403FYA | 100 µg | ||
| CBMOAB-16309FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO16309FYB | 100 µg | ||
| MO-AB-08781W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08781W | 100 µg | ||
| MO-AB-20725W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20725W | 100 µg | ||
| MO-AB-34061W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO34061W | 100 µg | ||
| MO-AB-47079W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO47079W | 100 µg | ||
| MO-AB-67910W | Monoclonal | Marmoset | WB, ELISA | MO67910W | 100 µg | ||
| MO-AB-22982R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22982R | 100 µg | ||
| MO-AB-31255R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31255R | 100 µg | ||
| MO-AB-23892H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23892C | 100 µg | ||
| MO-AB-30048H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO30048C | 100 µg | ||
| MO-AB-34033H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO34033C | 100 µg | ||
| MO-AB-01681L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01681L | 100 µg | ||
| MO-AB-07005Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO07005Y | 100 µg | ||
| MO-AB-10496Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10496Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Sea-anemone, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO14041Y |
| Specificity | This antibody binds to Sea-anemone Wnt2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene. (From NCBI) |
| Product Overview | This product is a mouse antibody against Wnt2. It can be used for Wnt2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein Wnt; Wnt2 |
| UniProt ID | Q5IHW2 |
| Protein Refseq | The length of the protein is 351 amino acids long. The sequence is show below: MAPAKARLGLLVLLILLYFPRKTESHWWFISQVFALGAKVMCNSITGLISIQRQMCLDNPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDATVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSCRNKKGRSRKGFEWGGCSDNIQYGLNFAKAFVDSREVEKDARALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQHLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRDDLVYLEDSPNYCMVDSNTGSLGTSGRECNGSASDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTCRRTVDKHICKAPSQP. |
See other products for " WNT2 "
| CBMOAB-13266HCB | AibGenesis™ Mouse Anti-WNT2 Antibody (CBMOAB-13266HCB) |
| MO-AB-04784Y | AibGenesis™ Mouse Anti-WNT2 Antibody (MO-AB-04784Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry