AibGenesis™ Mouse Anti-WNT8A Antibody (MO-AB-10505Y)
Cat: MO-AB-10505Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-10505Y | Monoclonal | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO10505Y | 100 µg | ||
| CBMOAB-16338FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO16338FYB | 100 µg | ||
| MO-AB-08430W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08430W | 100 µg | ||
| MO-AB-18040W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18040W | 100 µg | ||
| MO-AB-34072W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO34072W | 100 µg | ||
| MO-AB-35993W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35993W | 100 µg | ||
| MO-AB-42857W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42857W | 100 µg | ||
| MO-AB-67923W | Monoclonal | Marmoset | WB, ELISA | MO67923W | 100 µg | ||
| MO-AB-31263R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31263R | 100 µg | ||
| MO-AB-01691L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01691L | 100 µg | ||
| MO-AB-18268Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18268Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO10505Y |
| Specificity | This antibody binds to Rabbit WNT8A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and may be implicated in development of early embryos as well as germ cell tumors. Multiple alternatively spliced transcript variants have been found for this gene. (From NCBI) |
| Product Overview | This product is a mouse antibody against WNT8A. It can be used for WNT8A detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein Wnt; WNT8A |
| UniProt ID | G1SNE4 |
| Protein Refseq | The length of the protein is 371 amino acids long. The sequence is show below: PLPASLAVALSHTCSPAVGRAMGDLVLLWVAVGMCSATFRASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMHTITKNCSMGDFENCGCDESKNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVKATMRRTCKCHGISGSCSIQTCWLQLADFREMGDYLKAKYDRALKIEMDKRRLRAGNSAEGHWAPTEAFLPSAEAELVFLEESPDYCTRNSSLGVQGTEGRECLQHSHNTSRRERRSCGRLCSECGLQVEERRTEATSSCNCKFHWCCTVKCDQCRHVVNRYYCTRSPGTAQSWAKGS. |
See other products for " WNT8A "
For Research Use Only | Not For Clinical Use.
Online Inquiry