Mouse Anti-Yeast AAT1 Antibody (CBMOAB-00089CR)


Cat: CBMOAB-00089CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00089CR
SpecificityThis antibody binds to Yeast AAT1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol (By similarity).
Product OverviewMouse Anti-Yeast AAT1 (clone MO00089CR) Antibody (CBMOAB-00089CR) is a mouse antibody against AAT1. It can be used for AAT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAspartate aminotransferase, mitochondrial; EC 2.6.1.1; Transaminase A; AAT1; YKL106W
UniProt IDQ01802
Protein RefseqThe length of the protein is 451 amino acids long. The sequence is show below: MLRTRLTNCSLWRPYYTSSLSRVPRAPPDKVLGLSEHFKKVKNVNKIDLTVGIYKDGWGKVTTFPSVAKAQKLIESHLELNKNLSYLPITGSKEFQENVMKFLFKESCPQFGPFYLAHDRISFVQTLSGTGALAVAAKFLALFISRDIWIPDPSWANHKNIFQNNGFENIYRYSYYKDGQIDIDGWIEQLKTFAYNNQQENNKNPPCIILHACCHNPTGLDPTKEQWEKIIDTIYELKMVPIVDMAYQGLESGNLLKDAYLLRLCLNVNKYPNWSNGIFLCQSFAKNMGLYGERVGSLSVITPATANNGKFNPLQQKNSLQQNIDSQLKKIVRGMYSSPPGYGSRVVNVVLSDFKLKQQWFKDVDFMVQRLHHVRQEMFDRLGWPDLVNFAQQHGMFYYTRFSPKQVEILRNNYFVYLTGDGRLSLSGVNDSNVDYLCESLEAVSKMDKLA.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry