Cat: CBMOAB-00100CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast |
| Clone | MO00100CR |
| Specificity | This antibody binds to Yeast ACB1. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus; Extracellular region or secreted; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. |
| Product Overview | Mouse Anti-Yeast ACB1 (clone MO00100CR) Antibody (CBMOAB-00100CR) is a mouse antibody against ACB1. It can be used for ACB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Acyl-CoA-binding protein; ACBP; ACB1; ACB; YGR037C |
| UniProt ID | P31787 |
| Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS. |
For Research Use Only | Not For Clinical Use.