Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Yeast AIM23 Antibody (CBMOAB-00008CR)


Cat: CBMOAB-00008CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00008CR
SpecificityThis antibody binds to Yeast AIM23.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPresent with 319 molecules/cell in log phase SD medium.
Product OverviewMouse Anti-Yeast AIM23 (clone MO00008CR) Antibody (CBMOAB-00008CR) is a mouse antibody against AIM23. It can be used for AIM23 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAltered inheritance of mitochondria protein 23, mitochondrial; AIM23; YJL131C
UniProt IDP47015
Protein RefseqThe length of the protein is 356 amino acids long. The sequence is show below: MLKVPLSDVLSQKMLFLKSFRYFHCTKYFSRDNASSTTDIFRNAMKRKRELANLKEQSHGNVARNAAFPKEYIKRPKQVPRNATNRKKILITWSTGTDRAKEAANSVVSEIFKKNHKGNIKVVDPTTHRIEASNIRYFAKGIDLDKVGLSIVNVEQIDNENQIPLVKIVESRVALKKYSDFLAKKKEKELMELGVLNKSYKNLVTDKKEDNLKHIKISWQIESDDLKRQKAHEIVSLLKKGNKVTLYLDDKNNINSNNWLENFEELDRSQKGEPPRLPESVFQKRAAVLETLKEIVSEYANDPVLLGNMNSKMIMKLIPKDVKPQNNDKRALKELRKKERQEKLQKRIQRKKMNEM.
For Research Use Only | Not For Clinical Use.

Online Inquiry