Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Yeast AIM46 Antibody (CBMOAB-00011CR)


Cat: CBMOAB-00011CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00011CR
SpecificityThis antibody binds to Yeast AIM46.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPresent with 1350 molecules/cell in log phase SD medium.
Product OverviewMouse Anti-Yeast AIM46 (clone MO00011CR) Antibody (CBMOAB-00011CR) is a mouse antibody against AIM46. It can be used for AIM46 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAltered inheritance of mitochondria protein 46, mitochondrial; Found in mitochondrial proteome protein 34; AIM46; FMP34; YHR199C
UniProt IDP38885
Protein RefseqThe length of the protein is 310 amino acids long. The sequence is show below: MRLISKVLVKTNCLEVGMRRAPQWYSHYSTTAGNARVNKKGSKVVPVLTGLALASIFAKKWYDDSQIKKADATSVAVDASISAFPKKMGPPQWPFSTQYELIGKGVRCVSSITFKAYGLGIYVAAEDKHLVSEVLDSKFLSQAFIDTAAPPSPENSHQDNLRAALNDPAKAPILINNLLDSGIRLMSKNTPIKAGSFKLLMDGTKKSVLKNPDSQSQDKDRLEAGFQELHDCFRSVKGLVARDDDFFIELNKDCSMNLSYYARKKDEFVILGTVKEPLIGKLLFAHYLAAVDPPSPEARKEVIDALVSLS.
For Research Use Only | Not For Clinical Use.

Online Inquiry