Mouse Anti-Yeast ATG8 Antibody (CBMOAB-00395CR)
Cat: CBMOAB-00395CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast |
| Clone | MO00395CR |
| Specificity | This antibody binds to Yeast ATG8. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Vacuole; Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, mediates the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation is an important step required to facilitate multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Plays also a role in regulation of filamentous growth. |
| Product Overview | Mouse Anti-Yeast ATG8 Antibody is a mouse antibody against ATG8. It can be used for ATG8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier ATG8; Cytoplasm to vacuole targeting protein 5; ATG8; APG8 AUT7 CVT5; YBL078C |
| UniProt ID | P38182 |
| Protein Refseq | The length of the protein is 117 amino acids long. The sequence is show below: MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR. |
See other products for " ATG8 "
| MO-DKB-0063RA | Rabbit Anti-ATG8 Antibody (MO-DKB-0063RA) |
| MO-DKB-03765W | Rabbit Anti-ATG8 Antibody (Cat MO-DKB-03765W) |
| MOFAB-740W | Mouse Anti-Yeast Atg8 Antibody (MOFAB-740W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry