Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Yeast DIG2 Antibody (CBMOAB-00019CR)


Cat: CBMOAB-00019CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00019CR
SpecificityThis antibody binds to Yeast DIG2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDIG2 and DIG1 are negative regulators of the filamentation and pheromone induced mating program. DIG1 and DIG2 inhibit the transcriptional activity of STE12 by direct protein-protein interaction. DIG2 binds to the DNA binding domain (DBD) of STE12 and thus inhibits transcription when overexpressed.
Product OverviewMouse Anti-Yeast DIG2 (clone MO00019CR) Antibody (CBMOAB-00019CR) is a mouse antibody against DIG2. It can be used for DIG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDown-regulator of invasive growth 2; Regulator of STE12 protein 2; Regulator of sterile twelve 2; DIG2; RST2; YDR480W
UniProt IDQ03373
Protein RefseqThe length of the protein is 323 amino acids long. The sequence is show below: MNKEEQEDPQQEQISTVQENDPRNLQQLGMLLVSPGLDEDRLSEKMISKIKKSRDIEKNQKLLISRLSQKEEDHSGKPPTITTSPAEKTVPFKSLNHSLKRKRVPPALNFSDIQASSHLHGSKSAPPNITRFPQHKNSLRVRYMGRMAPTNQDYHPSVANSYMTATYPYPYTGLPPVPCYPYSSTPTQTHAYEGYYSPMYPGPLYNNGIIPADYHAKRKKLAGRSPHLEDLTSRKRTFVSKHHNGDPIISKTDEDIECSVTKNSLSEGASLNDDADDDNDKERIIIGEISLYDDVFKFEVRDDKNDYMKACETIWTEWHNLKK.
For Research Use Only | Not For Clinical Use.

Online Inquiry