Mouse Anti-Yeast MED6 Antibody (CBMOAB-02221CR)
Cat: CBMOAB-02221CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast |
Clone | MO02221CR |
Specificity | This antibody binds to Yeast MED6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins. |
Product Overview | Mouse Anti-Yeast MED6 Antibody is a mouse antibody against MED6. It can be used for MED6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Mediator of RNA polymerase II transcription subunit 6; Mediator complex subunit 6; MED6; MTR32; YHR058C |
UniProt ID | P38782 |
Protein Refseq | The length of the protein is 295 amino acids long. The sequence is show below: MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI. |
See other products for " MED6 "
MO-AB-15532R | Mouse Anti-Cattle MED6 Antibody (MO-AB-15532R) |
MO-AB-00883R | Mouse Anti-Medaka med6 Antibody (MO-AB-00883R) |
MO-AB-31751W | Mouse Anti-Dog MED6 Antibody (MO-AB-31751W) |
MO-AB-27042H | Mouse Anti-Rat Med6 Antibody (MO-AB-27042H) |
MO-AB-06097Y | Mouse Anti-A. aegpti MED6 Antibody (MO-AB-06097Y) |
CBMOAB-36375FYC | Mouse Anti-Arabidopsis MED6 Antibody (CBMOAB-36375FYC) |
MO-AB-23430H | Mouse Anti-Mallard MED6 Antibody (MO-AB-23430H) |
MO-AB-42073W | Mouse Anti-Guinea pig MED6 Antibody (MO-AB-42073W) |
MO-AB-08794Y | Mouse Anti-Rabbit MED6 Antibody (MO-AB-08794Y) |
CBMOAB-86466FYA | Mouse Anti-Zebrafish med6 Antibody (CBMOAB-86466FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry