Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Yeast YAP6 Antibody (CBMOAB-00069CR)


Cat: CBMOAB-00069CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00069CR
SpecificityThis antibody binds to Yeast YAP6.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription activator involved in the regulation of genes expressed in response to environmental changes and metabolic requirements. According to genome-wide promoter binding and gene expression studies it regulates, among others, genes involved in ribosome biogenesis, protein synthesis, carbohydrate metabolism, and carbohydrate transport. It may also be involved in pleiotropic drug resistance. When overexpressed, it confers resistance to cisplatin, methylmethanosulfonate, and mitomycin C, and increases cellular tolerance to sodium and lithium.
Product OverviewMouse Anti-Yeast YAP6 (clone MO00069CR) Antibody (CBMOAB-00069CR) is a mouse antibody against YAP6. It can be used for YAP6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP-1-like transcription factor YAP6; YAP6; HAL7; YDR259C
UniProt IDQ03935
Protein RefseqThe length of the protein is 383 amino acids long. The sequence is show below: MQNPPLIRPDMYNQGSSSMATYNASEKNLNEHPSPQIAQPSTSQKLPYRINPTTTNGDTDISVNSNPIQPPLPNLMHLSGPSDYRSMHQSPIHPSYIIPPHSNERKQSASYNRPQNAHVSIQPSVVFPPKSYSISYAPYQINPPLPNGLPNQSISLNKEYIAEEQLSTLPSRNTSVTTAPPSFQNSADTAKNSADNNDNNDNVTKPVPDKDTQLISSSGKTLRNTRRAAQNRTAQKAFRQRKEKYIKNLEQKSKIFDDLLAENNNFKSLNDSLRNDNNILIAQHEAIRNAITMLRSEYDVLCNENNMLKNENSIIKNEHNMSRNENENLKLENKRFHAEYIRMIEDIENTKRKEQEQRDEIEQLKKKIRSLEEIVGRHSDSAT.
For Research Use Only | Not For Clinical Use.

Online Inquiry