Mouse Anti-Yeast YML007C-A Antibody (CBMOAB-00073CR)


Cat: CBMOAB-00073CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00073CR
SpecificityThis antibody binds to Yeast YML007C-A.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Yeast YML007C-A (clone MO00073CR) Antibody (CBMOAB-00073CR) is a mouse antibody against YML007C-A. It can be used for YML007C-A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUncharacterized protein YML007C-A, mitochondrial; YML007C-A
UniProt IDQ3E7A6
Protein RefseqThe length of the protein is 36 amino acids long. The sequence is show below: MVHFIFIALRSMRFMRRLVRNLQYLLLPITSSLLFI.
For Research Use Only | Not For Clinical Use.

Online Inquiry