Mouse Anti-Yeast YNL097W-A Antibody (CBMOAB-00075CR)


Cat: CBMOAB-00075CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast
CloneMO00075CR
SpecificityThis antibody binds to Yeast YNL097W-A.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Yeast YNL097W-A (clone MO00075CR) Antibody (CBMOAB-00075CR) is a mouse antibody against YNL097W-A. It can be used for YNL097W-A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein YNL097W-A; YNL097W-A
UniProt IDQ8TGL8
Protein RefseqThe length of the protein is 51 amino acids long. The sequence is show below: MANGTILAHSLRHHTPPFPRMPLGYSSSRAVRRSRWFLVLISCCCCCFRRC.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry