Mouse Anti-yjefn3 Antibody (CBMOAB-16572FYB)


Cat: CBMOAB-16572FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16572FYB Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO16572FYB 100 µg
MO-AB-06980W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06980W 100 µg
MO-AB-30069H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30069C 100 µg
MO-AB-68040W Monoclonal Marmoset WB, ELISA MO68040W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO16572FYB
SpecificityThis antibody binds to Zebrafish yjefn3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionYJEFN3 (YjeF N-Terminal Domain Containing 3) is a Protein Coding gene. An important paralog of this gene is NAXE.
Product OverviewMouse Anti-Zebrafish yjefn3 Antibody is a mouse antibody against yjefn3. It can be used for yjefn3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesyjefn3; si:ch211-212d10.3; YjeF N-Terminal Domain Containing 3
UniProt IDQ1LVI2
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: MNHSSNEKEPETIEPLRYLSKTEVATVETELLRDYRFGQQQLIEIWGHACAIAITKAFPLSSLSKKQPTLLVVCGPEQNGSIGLVCARHLRMFEYEPTIFYPKRSTLGLHQDFTVQCEKMDIPFLSYLPTEVQLLNDAYNLVIDAILGPETDHKDVKEPYAGMLVTLKQVKIPIVSVDVPSGWDADEPAKDGINPEVLISLTAPKKCATGFSGKHFLAGRFLPYDIQKKYELNLPEFPGTECIIEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry