Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Zebrafish aagab Antibody (CBMOAB-63775FYA)


Cat: CBMOAB-63775FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63775FYA
SpecificityThis antibody binds to Zebrafish aagab.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene interacts with the gamma-adaptin and alpha-adaptin subunits of complexes involved in clathrin-coated vesicle trafficking. Mutations in this gene are associated with type I punctate palmoplantar keratoderma. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Zebrafish aagab (clone MO63775FYA) Antibody (CBMOAB-63775FYA) is a mouse antibody against aagab. It can be used for aagab detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92663; aagab; zgc:9266
UniProt IDQ6DH35
Protein RefseqThe length of the protein is 321 amino acids long.
The sequence is show below: MADDQGDEAPTLPCILVTSCDSNFKEEELIRQILSSESPPQPNRIEERVSWYPWTINNKYYTANVSLCVVSSTFDMNAEVARSMQAFIIYFDSKTKDSLNNVNSWLSVVEELAPEVLILVCDHVCDSDEGVSRQDAQQWCLAHAFELVELNPQDLPDEDDDFPESTGVKRTIQALNANVWSSVEMKDEHSQGFGLMSSLVASRHNNPRPSQETLSSHSPSNSTDEGTESQRAENNQSNTVDTAVDPMIDIDIQELANLTAGDPDVENFERLFTKLKEMKDKASSLPHEQRKVHAEKVAKAFWMAIGGDQDEIDGLSSGEES.
For Research Use Only | Not For Clinical Use.

Online Inquiry