Mouse Anti-Zebrafish abcc4 Antibody (CBMOAB-64379FYA)


Cat: CBMOAB-64379FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO64379FYA
SpecificityThis antibody binds to Zebrafish abcc4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish abcc4 (clone MO64379FYA) Antibody (CBMOAB-64379FYA) is a mouse antibody against abcc4. It can be used for abcc4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNovel ABC transporter similar to human multidrug-resistance proteins; MRP; abcc
UniProt IDQ7T022
Protein RefseqThe length of the protein is 61 amino acids long.
The sequence is show below: MEPIKKDAKSNPSASANLFSQIFFCWLNPLFSIGSKRRLEEDDMFNVLPEDRSKKLGEELQ.
For Research Use Only | Not For Clinical Use.

Online Inquiry