Mouse Anti-Zebrafish abcf1 Antibody (CBMOAB-64406FYA)


Cat: CBMOAB-64406FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO64406FYA
SpecificityThis antibody binds to Zebrafish abcf1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process.
Product OverviewMouse Anti-Zebrafish abcf1 (clone MO64406FYA) Antibody (CBMOAB-64406FYA) is a mouse antibody against abcf1. It can be used for abcf1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesabcf1; ATP Binding Cassette Subfamily F Member 1
UniProt IDA3KPX1
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MPKKSKEKAEWEGDDEPQTVDKHVKKGKKDKKDKKSFFEELASENKPEKEQPPVKEVQGKQPQKKKKDRRKGKPGDDEDDDEDSEVMQRLKKLSVQASDEEEEEEVVVPAKGGKRNKGGNIFAALSQGQSDDEDDEAGGDDNDDDDDKPRSKKSSKEASEDEQDEGAEKKDENEKKGGKKGKKAAAAAKPSKEEDDIEEKEQEKSQKKGKKEPPKKGKPARPPPSDDDEEEEEKSDDNDIM.
For Research Use Only | Not For Clinical Use.

Online Inquiry