Mouse Anti-Zebrafish abcg8 Antibody (CBMOAB-64432FYA)


Cat: CBMOAB-64432FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO64432FYA
SpecificityThis antibody binds to Zebrafish abcg8.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia.
Product OverviewMouse Anti-Zebrafish abcg8 (clone MO64432FYA) Antibody (CBMOAB-64432FYA) is a mouse antibody against abcg8. It can be used for abcg8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:172358 protein; abcg8; zgc:17235
UniProt IDA8WGD3
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MSDDTVFHSGESFSSSNEKQIKGRDILFSSPEEDSSLYFTYSGGRNELEVRNLNYEVDTAAQIPWYEKLSEFKMPWEMHSNKQTVIKDLNLHVHSGQMLAVIGSSGCGKTSLLDIITCRDEGGSMNSGEILINGKPSTRSLVKKSIAHVRQDDRLLPHLTVRETLAFVAKLRLPANFSQKQRDQRVDDVIAELRLRQCAHTHVGNEYVRGVSGGERRRVSIAVQLLWNPGILILDEPTSGLDSFTAHNLVITLYRLARGNRLVLLSVHQPRSDIFQLFDLVVLLSSGSAVYCGQAKDMVSYFTTLGYPCPRYCNPSDYYGEWDSKVMTDHFS.
For Research Use Only | Not For Clinical Use.

Online Inquiry