Cat: CBMOAB-63780FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio) |
Clone | MO63780FYA |
Specificity | This antibody binds to Zebrafish acy1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18. |
Product Overview | Mouse Anti-Zebrafish acy1 (clone MO63780FYA) Antibody (CBMOAB-63780FYA) is a mouse antibody against acy1. It can be used for acy1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | acy1; Aminoacylase 1 |
UniProt ID | F1QXZ4 |
Protein Refseq | The length of the protein is 202 amino acids long. The sequence is show below: MLPDKDGLNGGGGVQDGHPAEDPSVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRFSRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGE. |
See other products for " ACY1 "
MO-AB-50413W | Mouse Anti-Marmoset ACY1 Antibody (MO-AB-50413W) |
CBMOAB-00367HCB | Mouse Anti-C. elegans ACY1 Antibody (CBMOAB-00367HCB) |
MO-AB-50411W | Mouse Anti-Marmoset ACY1 Antibody (MO-AB-50411W) |
CBMOAB-00922FYA | Mouse Anti-D. melanogaster Acy1 Antibody (CBMOAB-00922FYA) |
CBMOAB-00923FYA | Mouse Anti-D. melanogaster Acy1 Antibody (CBMOAB-00923FYA) |
MO-AB-28810W | Mouse Anti-Dog ACY1 Antibody (MO-AB-28810W) |
MO-AB-50414W | Mouse Anti-Marmoset ACY1 Antibody (MO-AB-50414W) |
CBMOAB-63781FYA | Mouse Anti-Zebrafish acy1 Antibody (CBMOAB-63781FYA) |
CBMOAB-64839FYA | Mouse Anti-Zebrafish acy1 Antibody (CBMOAB-64839FYA) |
MO-AB-25680W | Mouse Anti-Chimpanzee ACY1 Antibody (MO-AB-25680W) |
For Research Use Only | Not For Clinical Use.