Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Zebrafish acy1 Antibody (CBMOAB-63780FYA)


Cat: CBMOAB-63780FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63780FYA
SpecificityThis antibody binds to Zebrafish acy1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18.
Product OverviewMouse Anti-Zebrafish acy1 (clone MO63780FYA) Antibody (CBMOAB-63780FYA) is a mouse antibody against acy1. It can be used for acy1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesacy1; Aminoacylase 1
UniProt IDF1QXZ4
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MLPDKDGLNGGGGVQDGHPAEDPSVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRFSRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGE.
For Research Use Only | Not For Clinical Use.

Online Inquiry