Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Zebrafish adprhl2 Antibody (CBMOAB-63783FYA)


Cat: CBMOAB-63783FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63783FYA
SpecificityThis antibody binds to Zebrafish adprhl2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ADP-ribosylglycohydrolase family. The encoded enzyme catalyzes the removal of ADP-ribose from ADP-ribosylated proteins. This enzyme localizes to the mitochondria, in addition to the nucleus and cytoplasm.
Product OverviewMouse Anti-Zebrafish adprhl2 (clone MO63783FYA) Antibody (CBMOAB-63783FYA) is a mouse antibody against adprhl2. It can be used for adprhl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92867 protein; adprhl2; zgc:9286
UniProt IDB2GP19
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MMLSRFRGALVGSVLGDCIGGEFEGAVDVPLDRVLQHLSALEDDTRGDGILQYSDDTAMMRCVADSLLTRMTFDERDMAQRFAKEYSHSPGRGYGSGVVQVLRKLASPHLKDVFQPAQAQFGGRGSFGNGGAMRAVPFALAFRSRADVRKYSRFGAMLTHSCSLGYNGAALQALAVHLSLQGALALPKDFIDKLISEMEELEKDETAKHDAKALNLSEFPYCSRLHRVKELMDKTSVSIEEVISELGNGIAALQSVPTAIFCVLYCLEPQDGLPERFGGLERTIAYSLALGGDTDTIACMAGAIAGAHYGIDSIPLSWQVSCEGVDEADDLARRLYDLYCLPQHNEDRGNNQPHTTNTD.

See other products for " adprhl2 "

CBMOAB-65077FYAMouse Anti-Zebrafish adprhl2 Antibody (CBMOAB-65077FYA)
CBMOAB-35245FYAMouse Anti-Rhesus ADPRHL2 Antibody (CBMOAB-35245FYA)
CBMOAB-35246FYAMouse Anti-Rhesus ADPRHL2 Antibody (CBMOAB-35246FYA)
CBMOAB-65078FYAMouse Anti-Zebrafish adprhl2 Antibody (CBMOAB-65078FYA)
For Research Use Only | Not For Clinical Use.

Online Inquiry