Mouse Anti-Zebrafish adprhl2 (clone MO63783FYA) Antibody (CBMOAB-63783FYA)


Cat: CBMOAB-63783FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63783FYA
SpecificityThis antibody binds to Zebrafish adprhl2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ADP-ribosylglycohydrolase family. The encoded enzyme catalyzes the removal of ADP-ribose from ADP-ribosylated proteins. This enzyme localizes to the mitochondria, in addition to the nucleus and cytoplasm.
Product OverviewMouse Anti-Zebrafish adprhl2 (clone MO63783FYA) Antibody (CBMOAB-63783FYA) is a mouse antibody against adprhl2. It can be used for adprhl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92867 protein; adprhl2; zgc:9286
UniProt IDB2GP19
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MMLSRFRGALVGSVLGDCIGGEFEGAVDVPLDRVLQHLSALEDDTRGDGILQYSDDTAMMRCVADSLLTRMTFDERDMAQRFAKEYSHSPGRGYGSGVVQVLRKLASPHLKDVFQPAQAQFGGRGSFGNGGAMRAVPFALAFRSRADVRKYSRFGAMLTHSCSLGYNGAALQALAVHLSLQGALALPKDFIDKLISEMEELEKDETAKHDAKALNLSEFPYCSRLHRVKELMDKTSVSIEEVISELGNGIAALQSVPTAIFCVLYCLEPQDGLPERFGGLERTIAYSLALGGDTDTIACMAGAIAGAHYGIDSIPLSWQVSCEGVDEADDLARRLYDLYCLPQHNEDRGNNQPHTTNTD.
For Research Use Only | Not For Clinical Use.

Online Inquiry