Mouse Anti-Zebrafish adprm Antibody (CBMOAB-65079FYA)


Cat: CBMOAB-65079FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO65079FYA
SpecificityThis antibody binds to Zebrafish adprm.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress (By similarity).
Product OverviewMouse Anti-Zebrafish adprm (clone MO65079FYA) Antibody (CBMOAB-65079FYA) is a mouse antibody against adprm. It can be used for adprm detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesManganese-dependent ADP-ribose/CDP-alcohol diphosphatase; adpr
UniProt IDF1R6I0
Protein RefseqThe length of the protein is 322 amino acids long.
The sequence is show below: MEDPVFTFGLIADVQYADIEDGENYLRTRRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRRDASDRALDTVMAELDACSVDVHHVWGNHEFYNFSRPSLLSSRLNSAQRTGTDTGSDLIGDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEESEKHTHSWRILTQHNHNLQDLNQPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVLSVLRSHQSVLCFIAGHDHDGGRCTDSSGAQHITLEGVIETPPHSHAFATAYLYEDRMVMKGRGRVEDLTITYS.
For Research Use Only | Not For Clinical Use.

Online Inquiry