Mouse Anti-Zebrafish ak2 Antibody (CBMOAB-65343FYA)


Cat: CBMOAB-65343FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO65343FYA
SpecificityThis antibody binds to Zebrafish ak2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.
Product OverviewMouse Anti-Zebrafish ak2 Antibody is a mouse antibody against ak2. It can be used for ak2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase 2, mitochondrial; AK 2; EC 2.7.4.3; ATP-AMP transphosphorylase 2; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; ak
UniProt IDQ1L8L9
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MAPSTQEDDTVSGIRKGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVSDEMVVELIDNNLDTPACKNGFLLDGFPRTVKQAEMLDDLMEKRSEKLDSVIEFSVDDSLLVRRICGRLIHQPSGRSYHEEFHPPKEHMKDDVTGEPLIRRSDDNETTLRSRLESYHRQTSPLVQYYSARGLHTAIDASQSTDLVFASILAAFSAATCKDLVYFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry