Mouse Anti-Zebrafish anapc1 Antibody (CBMOAB-65686FYA)


Cat: CBMOAB-65686FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO65686FYA
SpecificityThis antibody binds to Zebrafish anapc1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of the anaphase-promoting complex. This complex is an E3 ubiquitin ligase that regulates progression through the metaphase to anaphase portion of the cell cycle by ubiquitinating proteins which targets them for degradation.
Product OverviewMouse Anti-Zebrafish anapc1 (clone MO65686FYA) Antibody (CBMOAB-65686FYA) is a mouse antibody against anapc1. It can be used for anapc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesanapc1; Anaphase Promoting Complex Subunit 1
UniProt IDB8JIU1
Protein RefseqThe length of the protein is 500 amino acids long.
The sequence is show below: MSHVYEERATMIAAGELQSFVPFGREHCKNHPNAVNLQLRQLQPASELWSSDGAAGLVGSLQEVTLQERDKERWQLRKGTAPDDVEYDEELYVAGNMVIWSRGSKNQASCVYKAFTVDSPVQQALWCNFTVPQAKKDVKDVVEQTVCIVQSTCVNVHSMSGKDFISPLPFQVSALWPTKFGLLLERKNITVDGHMSPISREPLPTLFSMLHPLDEIAPVVCKSTGLFETRLQYVSDSALRVVFTCLKPSIIMTYDTQQCTHTVWNLRKVTSEEQNTVLKFPDQSGPAHTPNAAPSFLSTHLRNVNRLDSPASPLHCHALHNQSRIPASPALHSRVHSPSISNMAALSRAHSPGIAVPSFSGNQRFNMSCHTPSSRGHSILASPNSTLNDTLLPEMEPILPDLCIEQLWTETSAISREKGCQASKVFITSDLCENRYLCFLVESHQQLRCVKFLESNETSQLIFATVSTIAAKDAAPLEDIHTMLVLEANGSLVLYTGVTR.
For Research Use Only | Not For Clinical Use.

Online Inquiry