AibGenesis™ Mouse Anti-ba1 Antibody (CBMOAB-67358FYA)


Cat: CBMOAB-67358FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67358FYA Monoclonal Zebrafish (Danio rerio), French-bean, Maize (Zea mays) WB, ELISA MO67358FYA 100 µg
MO-AB-36081W Monoclonal French-bean WB, ELISA MO36081W 100 µg
MO-AB-47471W Monoclonal Maize (Zea mays) WB, ELISA MO47471W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), French-bean, Maize (Zea mays)
CloneMO67358FYA
SpecificityThis antibody binds to Zebrafish ba1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ba1 Antibody is a mouse antibody against ba1. It can be used for ba1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHemoglobin subunit beta-1; Beta-1-globin; Beta-A1-globin; Hemoglobin beta-1 chain; ba1; ba1l;
UniProt IDQ90486
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: MVEWTDAERTAILGLWGKLNIDEIGPQALSRCLIVYPWTQRYFATFGNLSSPAAIMGNPKVAAHGRTVMGGLERAIKNMDNVKNTYAALSVMHSEKLHVDPDNFRLLADCITVCAAMKFGQAGFNADVQEAWQKFLAVVVSALCRQYH.
For Research Use Only | Not For Clinical Use.
Online Inquiry