Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Zebrafish bcl2a Antibody (CBMOAB-63833FYA)


Cat: CBMOAB-63833FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63833FYA
SpecificityThis antibody binds to Zebrafish bcl2a.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish bcl2a (clone MO63833FYA) Antibody (CBMOAB-63833FYA) is a mouse antibody against bcl2a. It can be used for bcl2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesbcl2a
UniProt IDF1QBA9
Protein RefseqThe length of the protein is 45 amino acids long.
The sequence is show below: XDAFVEMYGQQRDSVFHPFSYLTKVLGLAALGLAGVTIGAFFAQK.
For Research Use Only | Not For Clinical Use.

Online Inquiry