Cat: CBMOAB-63833FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio) |
| Clone | MO63833FYA |
| Specificity | This antibody binds to Zebrafish bcl2a. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish bcl2a (clone MO63833FYA) Antibody (CBMOAB-63833FYA) is a mouse antibody against bcl2a. It can be used for bcl2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | bcl2a |
| UniProt ID | F1QBA9 |
| Protein Refseq | The length of the protein is 45 amino acids long. The sequence is show below: XDAFVEMYGQQRDSVFHPFSYLTKVLGLAALGLAGVTIGAFFAQK. |
See other products for " bcl2a "
| CBMOAB-67564FYA | Mouse Anti-Zebrafish bcl2a Antibody (CBMOAB-67564FYA) |
| MOFAB-007W | Rabbit Anti-bcl2a Antibody (MOFAB-007W) |
| CBMOAB-67565FYA | Mouse Anti-Zebrafish bcl2a Antibody (CBMOAB-67565FYA) |
For Research Use Only | Not For Clinical Use.