Mouse Anti-Zebrafish casp3a Antibody (CBMOAB-63868FYA)


Cat: CBMOAB-63868FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63868FYA
SpecificityThis antibody binds to Zebrafish casp3a.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish casp3a (clone MO63868FYA) Antibody (CBMOAB-63868FYA) is a mouse antibody against casp3a. It can be used for casp3a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaspase 3, apoptosis-related cysteine protease a; casp3a
UniProt IDQ98UI8
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: MNGDCVDAKRVDTTDASKDGASASQPMQVDAKPQSHAFRYSLNYPNIGHCIIINNKNFDRRTGMNPRNGTDVDAGNVMNVFRKLGYIVKVYNDQTVAQIMQVLTTVAHDDHSRCASLVCVLLSHGDEGVFFGTDTSVDLKSLTSLFRGDRCPSLVGKPKLFFIQACRGTELDPGVETDHTDHPDIPDGRERIPVEADFLYAYSTVPGYYSWRNTMTGSWFIQSLCEMMTKYGSELELLQIMTRVNHKVALDFESTSNMPGFDAKKQIPCIVSMLTKEMYFTP.
For Research Use Only | Not For Clinical Use.

Online Inquiry