Mouse Anti-Zebrafish cd40 Antibody (CBMOAB-69696FYA)


Cat: CBMOAB-69696FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO69696FYA
SpecificityThis antibody binds to Zebrafish cd40.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD40 (CD40 Molecule) is a Protein Coding gene. Diseases associated with CD40 include Immunodeficiency With Hyper-Igm, Type 3 and Cd40 Ligand Deficiency. Among its related pathways are NLR Proteins and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include enzyme binding and receptor activity. An important paralog of this gene is TNFRSF11A.
Product OverviewMouse Anti-Zebrafish cd40 Antibody is a mouse antibody against cd40. It can be used for cd40 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTNFR superfamily member 5; cd40; si:ch211-231h20.
UniProt IDB8X730
Protein RefseqThe length of the protein is 286 amino acids long.
The sequence is show below: MTVILRVCLLVTLICLVSCCEKETHYTNSQGKCCKMCGPGTRMMKDDNCDDPRCKECEVGEYQSGYTKETICERQPSCDTNLNFLPQMNSNKTSRNECQCKPGYYCDLDHGCEVCRKHTVCEPGQRVAVKGSPIRDNVCEECSDGTFSTNHSADTCKEWTKCEYGEVDTPGSSTSDQTCVGTRDRTAVIVVVCVLLILIAAAALVGCLFFKKGKSPLFKLQKQTFMEIRPDDDVTIAVQQQPEEEDENAPVSPTLSNMTENGNFVVQEHGKDAIIPCHESTSNTYQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry