AibGenesis™ Mouse Anti-cfap161 Antibody (CBMOAB-60920FYC)


Cat: CBMOAB-60920FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60920FYC Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Rhesus (Macaca mulatta) WB, ELISA MO60920FYC 100 µg
MO-AB-02349H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02349C 100 µg
MO-AB-03513W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03513W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Rhesus (Macaca mulatta)
CloneMO60920FYC
SpecificityThis antibody binds to Zebrafish cfap161.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cfap161 Antibody is a mouse antibody against cfap161. It can be used for cfap161 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUncharacterized protein C15orf26 homolog; cfap161
UniProt IDQ568D2
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: MAHVRTYNPRVRVGNWKEDVTLEEETSKEFILQKDRGELTVQKEGALKQSILKPVSLSVSQDGFLHFGDTVMLVNCGDGGHMQRSPCVLSIIADSSNVTSHSQTNTGPHLLGPLQVGGAHSMDPCVRNTFIIISVDGSSDGEVVRYDQSFALKTTGGFAGELFLASDHKSFQKCAKKSRLQELSLVEEFDFLCWWKVLYFDPQDRLENEGYPVQVNNKVLISHCKTNQCLAALSNHILWSQFGKEYELTAHTFLDSHKAEQDNNHWLFSTAHPANQSQSLLQLQQEEHKENQEDTQVKDCS.
For Research Use Only | Not For Clinical Use.
Online Inquiry