Mouse Anti-Zebrafish cox15 Antibody (CBMOAB-71384FYA)


Cat: CBMOAB-71384FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO71384FYA
SpecificityThis antibody binds to Zebrafish cox15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX15 (COX15, Cytochrome C Oxidase Assembly Homolog) is a Protein Coding gene. Diseases associated with COX15 include Cardioencephalomyopathy, Fatal Infantile, Due To Cytochrome C Oxidase Deficiency 2 and Leigh Syndrome. Among its related pathways are Metabolism and Porphyrin and chlorophyll metabolism. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity and oxidoreductase activity, acting on the CH-CH group of donors.
Product OverviewMouse Anti-Zebrafish cox15 Antibody is a mouse antibody against cox15. It can be used for cox15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOX15 homolog, cytochrome c oxidase assembly protein; Yeast; cox1
UniProt IDQ7ZV36
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MMLLRLAMCRCQAGRNLQQIQRTPLRQWLLQRGQNTVSSGAASVGSVSIRSAASDRLIGRWLLGCSGLVLGAVVLGGVTRLTESGLSMVDWHLVKEMKPPQTQAEWEQEFAKYQQFPEFKIMNHDMTLTEFKFIFYMEWGHRMWGRLVGLAYILPAAYFWRRGYFSRSMKTRVLGLCGFVVFQGLLGWYMVKSGLEEKPESYDVPRVSQYRLAAHLGSALLLYAASLWTGLTLLLPANRMPDSRQLLNLRRFAKMTGGLVFLTALSGAFVAGLDAGLVYNSFPRMGERWIPDDLLAFSPALKNVFENPTTVQFDHRILGIGSLTAITGLYLFSRRMILPRRAKMAISLLTAMAYTQVVLGISTLLLYVPTPLAATHQSGSVALLTFAIWVLAELRKVPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry